Lineage for d1fqka1 (1fqk A:61-181)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717222Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 2717223Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 2717224Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 2717225Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 2717276Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (19 PDB entries)
  8. 2717299Domain d1fqka1: 1fqk A:61-181 [18220]
    Other proteins in same PDB: d1fqka2, d1fqkb_, d1fqkc2, d1fqkd_
    species chimera
    complexed with alf, gdp, mg

Details for d1fqka1

PDB Entry: 1fqk (more details), 2.3 Å

PDB Description: crystal structure of the heterodimeric complex of the rgs domain of rgs9, and the gt/i1 chimera alpha subunit [(rgs9)-(gt/i1alpha)-(gdp)- (alf4-)-(mg2+)]
PDB Compounds: (A:) Guanine nucleotide-binding protein G(t) subunit alpha-1,Guanine nucleotide-binding protein G(i) subunit alpha-1,Guanine nucleotide-binding protein G(t) subunit alpha-1

SCOPe Domain Sequences for d1fqka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqka1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmpkems
diiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvkttgi
i

SCOPe Domain Coordinates for d1fqka1:

Click to download the PDB-style file with coordinates for d1fqka1.
(The format of our PDB-style files is described here.)

Timeline for d1fqka1: