Lineage for d1gfia1 (1gfi A:61-181)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002645Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 2002646Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 2002647Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 2002648Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 2002699Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (19 PDB entries)
  8. 2002705Domain d1gfia1: 1gfi A:61-181 [18219]
    Other proteins in same PDB: d1gfia2
    complexed with alf, gdp, mg

Details for d1gfia1

PDB Entry: 1gfi (more details), 2.2 Å

PDB Description: structures of active conformations of gi alpha 1 and the mechanism of gtp hydrolysis
PDB Compounds: (A:) guanine nucleotide-binding protein g

SCOPe Domain Sequences for d1gfia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gfia1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

SCOPe Domain Coordinates for d1gfia1:

Click to download the PDB-style file with coordinates for d1gfia1.
(The format of our PDB-style files is described here.)

Timeline for d1gfia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gfia2