SCOPe 2.05: Domain d3nduc_: 3ndu C:

Lineage for d3nduc_ (3ndu C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (446 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d3nduc_: 3ndu C: [182184]
   automated match to d1fgcc_
   complexed with act, cl, dms, gol, na, roc

Details for d3nduc_

PDB Entry: 3ndu, 1.25 Å

PDB Description: HIV-1 Protease Saquinavir:Ritonavir 1:5 complex structure

PDB Compounds: (C:) Protease

SCOPe Domain Sequences for d3nduc_:

Sequence; same for both SEQRES and ATOM records:

>d3nduc_ b.50.1.1 (C:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d3nduc_:

• d3nduc_ first appeared in SCOPe 2.01
  
• d3nduc_ appears in SCOPe 2.04
  
• d3nduc_ appears in SCOPe 2.06
  
• d3nduc_ appears in the current release, SCOPe 2.08