| Class a: All alpha proteins [46456] (202 folds) |
| Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) ![]() this domain interrupts the G-protein common fold |
| Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
| Protein Transducin (alpha subunit), insertion domain [47897] (2 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [47899] (18 PDB entries) |
| Domain d1gdd_1: 1gdd 61-181 [18218] Other proteins in same PDB: d1gdd_2 complexed with gdp, so4 |
PDB Entry: 1gdd (more details), 2.2 Å
SCOP Domain Sequences for d1gdd_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gdd_1 a.66.1.1 (61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus)}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t
Timeline for d1gdd_1: