Lineage for d3nd7f_ (3nd7 F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2860925Species Enterococcus faecalis [TaxId:1351] [189996] (3 PDB entries)
  8. 2860943Domain d3nd7f_: 3nd7 F: [182173]
    automated match to d1gn8a_
    complexed with pny

Details for d3nd7f_

PDB Entry: 3nd7 (more details), 2.4 Å

PDB Description: Crystal structure of phosphopantetheine adenylyltransferase from Enterococcus faecalis in the ligand-unbound state and in complex with ATP and pantetheine
PDB Compounds: (F:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3nd7f_:

Sequence, based on SEQRES records: (download)

>d3nd7f_ c.26.1.0 (F:) automated matches {Enterococcus faecalis [TaxId: 1351]}
mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
aeepyahvsssllkevlrfggdvsdylppniyhalkqk

Sequence, based on observed residues (ATOM records): (download)

>d3nd7f_ c.26.1.0 (F:) automated matches {Enterococcus faecalis [TaxId: 1351]}
mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
hvsssllkevlrfggdvsdylppniyhalkqk

SCOPe Domain Coordinates for d3nd7f_:

Click to download the PDB-style file with coordinates for d3nd7f_.
(The format of our PDB-style files is described here.)

Timeline for d3nd7f_: