Lineage for d1bof_1 (1bof 61-181)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4652Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
  4. 4653Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
  5. 4654Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 4655Protein Transducin (alpha subunit), insertion domain [47897] (2 species)
  7. 4673Species Rat (Rattus norvegicus) [TaxId:10116] [47899] (17 PDB entries)
  8. 4681Domain d1bof_1: 1bof 61-181 [18217]
    Other proteins in same PDB: d1bof_2

Details for d1bof_1

PDB Entry: 1bof (more details), 2.2 Å

PDB Description: gi-alpha-1 bound to gdp and magnesium

SCOP Domain Sequences for d1bof_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bof_1 a.66.1.1 (61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus)}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

SCOP Domain Coordinates for d1bof_1:

Click to download the PDB-style file with coordinates for d1bof_1.
(The format of our PDB-style files is described here.)

Timeline for d1bof_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bof_2