Lineage for d3nd7a_ (3nd7 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1841352Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1841999Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1842000Protein automated matches [190459] (41 species)
    not a true protein
  7. 1842070Species Enterococcus faecalis [TaxId:1351] [189996] (3 PDB entries)
  8. 1842083Domain d3nd7a_: 3nd7 A: [182168]
    automated match to d1gn8a_
    complexed with pny

Details for d3nd7a_

PDB Entry: 3nd7 (more details), 2.4 Å

PDB Description: Crystal structure of phosphopantetheine adenylyltransferase from Enterococcus faecalis in the ligand-unbound state and in complex with ATP and pantetheine
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3nd7a_:

Sequence, based on SEQRES records: (download)

>d3nd7a_ c.26.1.0 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]}
mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
aeepyahvsssllkevlrfggdvsdylppniyhalkqk

Sequence, based on observed residues (ATOM records): (download)

>d3nd7a_ c.26.1.0 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]}
mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
hvsssllkevlrfggdvsdylppniyhalkqk

SCOPe Domain Coordinates for d3nd7a_:

Click to download the PDB-style file with coordinates for d3nd7a_.
(The format of our PDB-style files is described here.)

Timeline for d3nd7a_: