Lineage for d3nd6f_ (3nd6 F:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590100Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1590710Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 1590711Protein automated matches [190459] (36 species)
    not a true protein
  7. 1590779Species Enterococcus faecalis [TaxId:1351] [189996] (3 PDB entries)
  8. 1590791Domain d3nd6f_: 3nd6 F: [182167]
    automated match to d1gn8a_
    complexed with atp

Details for d3nd6f_

PDB Entry: 3nd6 (more details), 2.3 Å

PDB Description: Crystal structure of phosphopantetheine adenylyltransferase (PPAT) in complex with ATP from Enterococcus faecalis
PDB Compounds: (F:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3nd6f_:

Sequence, based on SEQRES records: (download)

>d3nd6f_ c.26.1.0 (F:) automated matches {Enterococcus faecalis [TaxId: 1351]}
mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
aeepyahvsssllkevlrfggdvsdylppniyhalkqk

Sequence, based on observed residues (ATOM records): (download)

>d3nd6f_ c.26.1.0 (F:) automated matches {Enterococcus faecalis [TaxId: 1351]}
mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
hvsssllkevlrfggdvsdylppniyhalkqk

SCOPe Domain Coordinates for d3nd6f_:

Click to download the PDB-style file with coordinates for d3nd6f_.
(The format of our PDB-style files is described here.)

Timeline for d3nd6f_: