SCOPe 2.03: Domain d3nd6d_: 3nd6 D:

Lineage for d3nd6d_ (3nd6 D:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (31 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:1351] [189996] (3 PDB entries)

8. Domain d3nd6d_: 3nd6 D: [182165]
   automated match to d1gn8a_
   complexed with atp

Details for d3nd6d_

PDB Entry: 3nd6, 2.3 Å

PDB Description: Crystal structure of phosphopantetheine adenylyltransferase (PPAT) in complex with ATP from Enterococcus faecalis

PDB Compounds: (D:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d3nd6d_:

Sequence, based on SEQRES records:

>d3nd6d_ c.26.1.0 (D:) automated matches {Enterococcus faecalis [TaxId: 1351]}
mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
aeepyahvsssllkevlrfggdvsdylppniyhalkqk

Sequence, based on observed residues (ATOM records):

>d3nd6d_ c.26.1.0 (D:) automated matches {Enterococcus faecalis [TaxId: 1351]}
mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
hvsssllkevlrfggdvsdylppniyhalkqk

Timeline for d3nd6d_:

• d3nd6d_ first appeared in SCOPe 2.01
  
• d3nd6d_ appears in SCOPe 2.02
  
• d3nd6d_ appears in SCOPe 2.04
  
• d3nd6d_ appears in the current release, SCOPe 2.08