Lineage for d3ncrb_ (3ncr B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950865Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2950866Protein automated matches [190753] (21 species)
    not a true protein
  7. 2950874Species Archaeoglobus fulgidus [TaxId:2234] [189419] (4 PDB entries)
  8. 2950879Domain d3ncrb_: 3ncr B: [182153]
    Other proteins in same PDB: d3ncra2, d3ncrc2
    automated match to d1qy7a_
    complexed with act, adp, cl, mg, po4

Details for d3ncrb_

PDB Entry: 3ncr (more details), 1.44 Å

PDB Description: GlnK2 from Archaeoglubus fulgidus, ADP complex
PDB Compounds: (B:) Nitrogen regulatory protein P-II (GlnB-2)

SCOPe Domain Sequences for d3ncrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ncrb_ d.58.5.0 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mkkieaivraekfpevkaaleergfygmtvtdvkgrgqqggmqiqfrgrtmevtllpkvk
leivvkddaveeviglivnsaftgspgdgkifiipvedvvrirtgergddsl

SCOPe Domain Coordinates for d3ncrb_:

Click to download the PDB-style file with coordinates for d3ncrb_.
(The format of our PDB-style files is described here.)

Timeline for d3ncrb_: