Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (16 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:2234] [189419] (4 PDB entries) |
Domain d3ncra1: 3ncr A:1-112 [182152] Other proteins in same PDB: d3ncra2, d3ncrc2 automated match to d1qy7a_ complexed with act, adp, cl, mg, po4 |
PDB Entry: 3ncr (more details), 1.44 Å
SCOPe Domain Sequences for d3ncra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ncra1 d.58.5.0 (A:1-112) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} mkkieaivraekfpevkaaleergfygmtvtdvkgrgqqggmqiqfrgrtmevtllpkvk leivvkddaveeviglivnsaftgspgdgkifiipvedvvrirtgergddsl
Timeline for d3ncra1: