SCOPe 2.08: Domain d3ncra1: 3ncr A:1-112

Lineage for d3ncra1 (3ncr A:1-112)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (21 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [189419] (4 PDB entries)

8. Domain d3ncra1: 3ncr A:1-112 [182152]
   Other proteins in same PDB: d3ncra2, d3ncrc2
   automated match to d1qy7a_
   complexed with act, adp, cl, mg, po4

Details for d3ncra1

PDB Entry: 3ncr, 1.44 Å

PDB Description: GlnK2 from Archaeoglubus fulgidus, ADP complex

PDB Compounds: (A:) Nitrogen regulatory protein P-II (GlnB-2)

SCOPe Domain Sequences for d3ncra1:

Sequence; same for both SEQRES and ATOM records:

>d3ncra1 d.58.5.0 (A:1-112) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mkkieaivraekfpevkaaleergfygmtvtdvkgrgqqggmqiqfrgrtmevtllpkvk
leivvkddaveeviglivnsaftgspgdgkifiipvedvvrirtgergddsl

Timeline for d3ncra1:

• d3ncra1 first appeared in SCOPe 2.01, called d3ncra_
  
• d3ncra1 appears in SCOPe 2.07