SCOPe 2.06: Domain d3ncqc1: 3ncq C:1-112

Lineage for d3ncqc1 (3ncq C:1-112)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (16 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [189419] (4 PDB entries)

8. Domain d3ncqc1: 3ncq C:1-112 [182151]
   Other proteins in same PDB: d3ncqc2
   automated match to d1qy7a_
   complexed with act, atp, cl, mg, po4

Details for d3ncqc1

PDB Entry: 3ncq, 1.24 Å

PDB Description: GlnK2 from Archaeoglobus fulgidus, ATP complex

PDB Compounds: (C:) Nitrogen regulatory protein P-II (GlnB-2)

SCOPe Domain Sequences for d3ncqc1:

Sequence; same for both SEQRES and ATOM records:

>d3ncqc1 d.58.5.0 (C:1-112) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mkkieaivraekfpevkaaleergfygmtvtdvkgrgqqggmqiqfrgrtmevtllpkvk
leivvkddaveeviglivnsaftgspgdgkifiipvedvvrirtgergddsl

Timeline for d3ncqc1:

• d3ncqc1 first appeared in SCOPe 2.01, called d3ncqc_
  
• d3ncqc1 was called d3ncqc_ in SCOPe 2.05
  
• d3ncqc1 appears in SCOPe 2.07
  
• d3ncqc1 appears in the current release, SCOPe 2.08