SCOPe 2.06: Domain d3ncqb_: 3ncq B:

Lineage for d3ncqb_ (3ncq B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (16 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [189419] (4 PDB entries)

8. Domain d3ncqb_: 3ncq B: [182150]
   Other proteins in same PDB: d3ncqc2
   automated match to d1qy7a_
   complexed with act, atp, cl, mg, po4

Details for d3ncqb_

PDB Entry: 3ncq, 1.24 Å

PDB Description: GlnK2 from Archaeoglobus fulgidus, ATP complex

PDB Compounds: (B:) Nitrogen regulatory protein P-II (GlnB-2)

SCOPe Domain Sequences for d3ncqb_:

Sequence; same for both SEQRES and ATOM records:

>d3ncqb_ d.58.5.0 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mkkieaivraekfpevkaaleergfygmtvtdvkgrgqqggmqiqfrgrtmevtllpkvk
leivvkddaveeviglivnsaftgspgdgkifiipvedvvrirtgergddsl

Timeline for d3ncqb_:

• d3ncqb_ first appeared in SCOPe 2.01
  
• d3ncqb_ appears in SCOPe 2.05
  
• d3ncqb_ appears in SCOPe 2.07
  
• d3ncqb_ appears in the current release, SCOPe 2.08