Lineage for d1fqja1 (1fqj A:61-181)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330344Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 2330345Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 2330346Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 2330347Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 2330398Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (19 PDB entries)
  8. 2330419Domain d1fqja1: 1fqj A:61-181 [18215]
    Other proteins in same PDB: d1fqja2, d1fqjb_, d1fqjc_, d1fqjd2, d1fqje_
    species chimera
    complexed with alf, gdp, mg

Details for d1fqja1

PDB Entry: 1fqj (more details), 2.02 Å

PDB Description: crystal structure of the heterotrimeric complex of the rgs domain of rgs9, the gamma subunit of phosphodiesterase and the gt/i1 chimera alpha subunit [(rgs9)-(pdegamma)-(gt/i1alpha)-(gdp)-(alf4-)-(mg2+)]
PDB Compounds: (A:) Guanine nucleotide-binding protein G(t) subunit alpha-1,Guanine nucleotide-binding protein G(i) subunit alpha-1,Guanine nucleotide-binding protein G(t) subunit alpha-1

SCOPe Domain Sequences for d1fqja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqja1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmpkems
diiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvkttgi
i

SCOPe Domain Coordinates for d1fqja1:

Click to download the PDB-style file with coordinates for d1fqja1.
(The format of our PDB-style files is described here.)

Timeline for d1fqja1: