| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
| Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
| Protein automated matches [190753] (21 species) not a true protein |
| Species Archaeoglobus fulgidus [TaxId:2234] [189419] (4 PDB entries) |
| Domain d3ncpd_: 3ncp D: [182148] Other proteins in same PDB: d3ncpc2 automated match to d1qy7a_ complexed with cl |
PDB Entry: 3ncp (more details), 2.35 Å
SCOPe Domain Sequences for d3ncpd_:
Sequence, based on SEQRES records: (download)
>d3ncpd_ d.58.5.0 (D:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mkkieaivraekfpevkaaleergfygmtvtdvkgrgqqggmqiqfrgrtmevtllpkvk
leivvkddaveeviglivnsaftgspgdgkifiipvedvvrirtgergddsl
>d3ncpd_ d.58.5.0 (D:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mkkieaivraekfpevkaaleergfygmtvtdvkgrgqevtllpkvkleivvkddaveev
iglivnsaftgspgdgkifiipvedvvrirtgergddsl
Timeline for d3ncpd_:
View in 3DDomains from other chains: (mouse over for more information) d3ncpa_, d3ncpb_, d3ncpc1, d3ncpc2 |