Lineage for d3ncpd_ (3ncp D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557428Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2557730Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2557731Protein automated matches [190753] (21 species)
    not a true protein
  7. 2557739Species Archaeoglobus fulgidus [TaxId:2234] [189419] (4 PDB entries)
  8. 2557750Domain d3ncpd_: 3ncp D: [182148]
    Other proteins in same PDB: d3ncpc2
    automated match to d1qy7a_
    complexed with cl

Details for d3ncpd_

PDB Entry: 3ncp (more details), 2.35 Å

PDB Description: GlnK2 from Archaeoglobus fulgidus
PDB Compounds: (D:) Nitrogen regulatory protein P-II (GlnB-2)

SCOPe Domain Sequences for d3ncpd_:

Sequence, based on SEQRES records: (download)

>d3ncpd_ d.58.5.0 (D:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mkkieaivraekfpevkaaleergfygmtvtdvkgrgqqggmqiqfrgrtmevtllpkvk
leivvkddaveeviglivnsaftgspgdgkifiipvedvvrirtgergddsl

Sequence, based on observed residues (ATOM records): (download)

>d3ncpd_ d.58.5.0 (D:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mkkieaivraekfpevkaaleergfygmtvtdvkgrgqevtllpkvkleivvkddaveev
iglivnsaftgspgdgkifiipvedvvrirtgergddsl

SCOPe Domain Coordinates for d3ncpd_:

Click to download the PDB-style file with coordinates for d3ncpd_.
(The format of our PDB-style files is described here.)

Timeline for d3ncpd_: