Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (21 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:2234] [189419] (4 PDB entries) |
Domain d3ncpc1: 3ncp C:1-112 [182147] Other proteins in same PDB: d3ncpc2 automated match to d1qy7a_ complexed with cl |
PDB Entry: 3ncp (more details), 2.35 Å
SCOPe Domain Sequences for d3ncpc1:
Sequence, based on SEQRES records: (download)
>d3ncpc1 d.58.5.0 (C:1-112) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} mkkieaivraekfpevkaaleergfygmtvtdvkgrgqqggmqiqfrgrtmevtllpkvk leivvkddaveeviglivnsaftgspgdgkifiipvedvvrirtgergddsl
>d3ncpc1 d.58.5.0 (C:1-112) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} mkkieaivraekfpevkaaleergfygmtvtdvkgrgqevtllpkvkleivvkddaveev iglivnsaftgspgdgkifiipvedvvrirtgergddsl
Timeline for d3ncpc1: