Lineage for d3nbuf_ (3nbu F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140302Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 protein domains)
    permutation of the double-SIS domain fold
    automatically mapped to Pfam PF00342
  6. 2140362Protein automated matches [190137] (5 species)
    not a true protein
  7. 2140363Species Escherichia coli [TaxId:668369] [190004] (1 PDB entry)
  8. 2140369Domain d3nbuf_: 3nbu F: [182142]
    automated match to d1dqra_
    complexed with cl

Details for d3nbuf_

PDB Entry: 3nbu (more details), 2.05 Å

PDB Description: Crystal structure of pGI glucosephosphate isomerase
PDB Compounds: (F:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d3nbuf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nbuf_ c.80.1.2 (F:) automated matches {Escherichia coli [TaxId: 668369]}
mkninptqtaawqalqkhfdemkdvtiadlfakdgdrfskfsatfddqmlvdysknrite
etlaklqdlakecdlagaiksmfsgekinrtenravlhvalrnrsntpilvdgkdvmpev
navlekmktfseaiisgewkgytgkaitdvvnigiggsdlgpymvtealrpyknhlnmhf
vsnvdgthiaevlkkvnpettlflvasktfttqetmtnahsardwflkaagdekhvakhf
talstnakavgefgidtanmfefwdwvggryslwsaiglsivlsigfdnfvellsgaham
dkhfsttpaeknlpvllaligiwynnffgaeteailpydqymhrfaayfqqgnmesngky
vdrngnvvdyqtgpiiwgepgtngqhafyqlihqgtkmvpcdfiapaithnplsdhhqkl
lsnffaqtealafgksrevveqeyrdqgkdpatldyvvpfkvfegnrptnsillreitpf
slgalialyehkiftqgvilniftfdqwgvelgkqlanrilpelkddkeisshdsstngl
inrykawrg

SCOPe Domain Coordinates for d3nbuf_:

Click to download the PDB-style file with coordinates for d3nbuf_.
(The format of our PDB-style files is described here.)

Timeline for d3nbuf_: