Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
Superfamily c.80.1: SIS domain [53697] (4 families) |
Family c.80.1.2: Phosphoglucose isomerase, PGI [53701] (2 proteins) permutation of the double-SIS domain fold automatically mapped to Pfam PF00342 |
Protein automated matches [190137] (5 species) not a true protein |
Species Escherichia coli [TaxId:668369] [190004] (1 PDB entry) |
Domain d3nbud_: 3nbu D: [182140] automated match to d1dqra_ complexed with cl |
PDB Entry: 3nbu (more details), 2.05 Å
SCOPe Domain Sequences for d3nbud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nbud_ c.80.1.2 (D:) automated matches {Escherichia coli [TaxId: 668369]} mkninptqtaawqalqkhfdemkdvtiadlfakdgdrfskfsatfddqmlvdysknrite etlaklqdlakecdlagaiksmfsgekinrtenravlhvalrnrsntpilvdgkdvmpev navlekmktfseaiisgewkgytgkaitdvvnigiggsdlgpymvtealrpyknhlnmhf vsnvdgthiaevlkkvnpettlflvasktfttqetmtnahsardwflkaagdekhvakhf talstnakavgefgidtanmfefwdwvggryslwsaiglsivlsigfdnfvellsgaham dkhfsttpaeknlpvllaligiwynnffgaeteailpydqymhrfaayfqqgnmesngky vdrngnvvdyqtgpiiwgepgtngqhafyqlihqgtkmvpcdfiapaithnplsdhhqkl lsnffaqtealafgksrevveqeyrdqgkdpatldyvvpfkvfegnrptnsillreitpf slgalialyehkiftqgvilniftfdqwgvelgkqlanrilpelkddkeisshdsstngl inrykawrg
Timeline for d3nbud_: