Class a: All alpha proteins [46456] (179 folds) |
Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) this domain interrupts the G-protein common fold |
Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
Protein Transducin (alpha subunit), insertion domain [47897] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [47899] (18 PDB entries) |
Domain d1bh2_1: 1bh2 61-181 [18214] Other proteins in same PDB: d1bh2_2 complexed with gsp, mg; mutant |
PDB Entry: 1bh2 (more details), 2.1 Å
SCOP Domain Sequences for d1bh2_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bh2_1 a.66.1.1 (61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus)} yseeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmt aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk t
Timeline for d1bh2_1: