SCOP 1.59: Domain d1gota1: 1got A:61-181

Lineage for d1gota1 (1got A:61-181)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47899] (17 PDB entries)

8. Domain d1gota1: 1got A:61-181 [18213]
   Other proteins in same PDB: d1gota2, d1gotb_, d1gotg_

Details for d1gota1

PDB Entry: 1got, 2 Å

PDB Description: heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits

SCOP Domain Sequences for d1gota1:

Sequence; same for both SEQRES and ATOM records:

>d1gota1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus)}
eclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmpkems
diiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvkttgi
i

Timeline for d1gota1:

• d1gota1 first appeared (with stable ids) in SCOP 1.55
  
• d1gota1 appears in SCOP 1.57
  
• d1gota1 appears in SCOP 1.61
  
• d1gota1 appears in the current release, SCOPe 2.08