SCOPe 2.07: Domain d3nb7a_: 3nb7 A:

Lineage for d3nb7a_ (3nb7 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.10: PBP transglycosylase domain-like [159832] (3 proteins)
   Pfam PF00912; lacking the characteristic beta-sheet; otherwise has a similar fold to the Family 19 glycosidase

6. Protein automated matches [191294] (1 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:63363] [189954] (2 PDB entries)

8. Domain d3nb7a_: 3nb7 A: [182124]
   automated match to d2oqoa1

Details for d3nb7a_

PDB Entry: 3nb7, 2.65 Å

PDB Description: Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin

PDB Compounds: (A:) penicillin-binding protein 1a

SCOPe Domain Sequences for d3nb7a_:

Sequence, based on SEQRES records:

>d3nb7a_ d.2.1.10 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
giqkrfyvsidkipehvinafvatedrnfwhhfgidpvaivraaivnyragrivqggsti
tqqlaknlfltrertlerkikeallaikiertfdkkkimelylnqiylgsgaygveaaaq
vyfgkhvwelsldeaallaalpkapakynpfyhperalqrrnlvlkrmleegyitpeqye
eavnk

Sequence, based on observed residues (ATOM records):

>d3nb7a_ d.2.1.10 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
giqkrfyvsidkipehvinafvatedrnfwhhfgidpvaivraaivqggstitqqlaknl
fltrertlerkikeallaikiertfdkkkimelylnqiylgsgaygveaaaqvyfgkhvw
elsldeaallaalpkapakynpfyhperalqrrnlvlkrmleegyitpeqyeeavnk

Timeline for d3nb7a_:

• d3nb7a_ first appeared in SCOPe 2.01
  
• d3nb7a_ appears in SCOPe 2.06
  
• d3nb7a_ appears in the current release, SCOPe 2.08