Lineage for d3nb7a_ (3nb7 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2533651Family d.2.1.10: PBP transglycosylase domain-like [159832] (3 proteins)
    Pfam PF00912; lacking the characteristic beta-sheet; otherwise has a similar fold to the Family 19 glycosidase
  6. 2533665Protein automated matches [191294] (1 species)
    not a true protein
  7. 2533666Species Aquifex aeolicus [TaxId:63363] [189954] (2 PDB entries)
  8. 2533668Domain d3nb7a_: 3nb7 A: [182124]
    automated match to d2oqoa1

Details for d3nb7a_

PDB Entry: 3nb7 (more details), 2.65 Å

PDB Description: Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin
PDB Compounds: (A:) penicillin-binding protein 1a

SCOPe Domain Sequences for d3nb7a_:

Sequence, based on SEQRES records: (download)

>d3nb7a_ d.2.1.10 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
giqkrfyvsidkipehvinafvatedrnfwhhfgidpvaivraaivnyragrivqggsti
tqqlaknlfltrertlerkikeallaikiertfdkkkimelylnqiylgsgaygveaaaq
vyfgkhvwelsldeaallaalpkapakynpfyhperalqrrnlvlkrmleegyitpeqye
eavnk

Sequence, based on observed residues (ATOM records): (download)

>d3nb7a_ d.2.1.10 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
giqkrfyvsidkipehvinafvatedrnfwhhfgidpvaivraaivqggstitqqlaknl
fltrertlerkikeallaikiertfdkkkimelylnqiylgsgaygveaaaqvyfgkhvw
elsldeaallaalpkapakynpfyhperalqrrnlvlkrmleegyitpeqyeeavnk

SCOPe Domain Coordinates for d3nb7a_:

Click to download the PDB-style file with coordinates for d3nb7a_.
(The format of our PDB-style files is described here.)

Timeline for d3nb7a_: