![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.10: PBP transglycosylase domain-like [159832] (3 proteins) Pfam PF00912; lacking the characteristic beta-sheet; otherwise has a similar fold to the Family 19 glycosidase |
![]() | Protein automated matches [191294] (1 species) not a true protein |
![]() | Species Aquifex aeolicus [TaxId:63363] [189954] (2 PDB entries) |
![]() | Domain d3nb7a_: 3nb7 A: [182124] automated match to d2oqoa1 |
PDB Entry: 3nb7 (more details), 2.65 Å
SCOPe Domain Sequences for d3nb7a_:
Sequence, based on SEQRES records: (download)
>d3nb7a_ d.2.1.10 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]} giqkrfyvsidkipehvinafvatedrnfwhhfgidpvaivraaivnyragrivqggsti tqqlaknlfltrertlerkikeallaikiertfdkkkimelylnqiylgsgaygveaaaq vyfgkhvwelsldeaallaalpkapakynpfyhperalqrrnlvlkrmleegyitpeqye eavnk
>d3nb7a_ d.2.1.10 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]} giqkrfyvsidkipehvinafvatedrnfwhhfgidpvaivraaivqggstitqqlaknl fltrertlerkikeallaikiertfdkkkimelylnqiylgsgaygveaaaqvyfgkhvw elsldeaallaalpkapakynpfyhperalqrrnlvlkrmleegyitpeqyeeavnk
Timeline for d3nb7a_: