SCOPe 2.01: Domain d1as0a1: 1as0 A:61-181

Lineage for d1as0a1 (1as0 A:61-181)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (24 PDB entries)

8. Domain d1as0a1: 1as0 A:61-181 [18212]
   Other proteins in same PDB: d1as0a2
   complexed with gsp, mg, so4

Details for d1as0a1

PDB Entry: 1as0, 2 Å

PDB Description: gtp-gamma-s bound g42v gia1

PDB Compounds: (A:) gia1

SCOPe Domain Sequences for d1as0a1:

Sequence; same for both SEQRES and ATOM records:

>d1as0a1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Timeline for d1as0a1:

• d1as0a1 first appeared (with stable ids) in SCOP 1.55, called d1as0_1
  
• d1as0a1 appears in SCOP 1.75
  
• d1as0a1 appears in SCOPe 2.02
  
• d1as0a1 appears in the current release, SCOPe 2.08