Lineage for d1giaa1 (1gia A:61-181)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717222Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 2717223Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 2717224Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 2717225Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 2717276Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (19 PDB entries)
  8. 2717278Domain d1giaa1: 1gia A:61-181 [18211]
    Other proteins in same PDB: d1giaa2
    complexed with gsp, mg

Details for d1giaa1

PDB Entry: 1gia (more details), 2 Å

PDB Description: structure of active conformations of gia1 and the mechanism of gtp hydrolysis
PDB Compounds: (A:) g protein gi alpha 1

SCOPe Domain Sequences for d1giaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1giaa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

SCOPe Domain Coordinates for d1giaa1:

Click to download the PDB-style file with coordinates for d1giaa1.
(The format of our PDB-style files is described here.)

Timeline for d1giaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1giaa2