Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
Protein automated matches [190231] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189528] (4 PDB entries) |
Domain d3n9yd_: 3n9y D: [182108] automated match to d1e6eb_ complexed with clr, fes, hem |
PDB Entry: 3n9y (more details), 2.1 Å
SCOPe Domain Sequences for d3n9yd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n9yd_ d.15.4.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} slldvvvennldidgfgacegtlacstchlifedhiyekldaitdeendmldlaygltdr srlgcqic
Timeline for d3n9yd_: