![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
![]() | Protein automated matches [190231] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189528] (5 PDB entries) |
![]() | Domain d3n9yd_: 3n9y D: [182108] Other proteins in same PDB: d3n9ya_, d3n9yb_ automated match to d1e6eb_ complexed with clr, fes, hem fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 3n9y (more details), 2.1 Å
SCOPe Domain Sequences for d3n9yd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n9yd_ d.15.4.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} slldvvvennldidgfgacegtlacstchlifedhiyekldaitdeendmldlaygltdr srlgcqic
Timeline for d3n9yd_: