Lineage for d3n9yc_ (3n9y C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933781Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2933918Protein automated matches [190231] (14 species)
    not a true protein
  7. 2933945Species Human (Homo sapiens) [TaxId:9606] [189528] (5 PDB entries)
  8. 2933954Domain d3n9yc_: 3n9y C: [182107]
    Other proteins in same PDB: d3n9ya_, d3n9yb_
    automated match to d1e6eb_
    complexed with clr, fes, hem

    fragment; missing more than one-third of the common structure and/or sequence

Details for d3n9yc_

PDB Entry: 3n9y (more details), 2.1 Å

PDB Description: crystal structure of human cyp11a1 in complex with cholesterol
PDB Compounds: (C:) adrenodoxin

SCOPe Domain Sequences for d3n9yc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n9yc_ d.15.4.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slldvvvennldidgfgacegtlacstchlifedhiyekldaitdeendmldlaygltdr
srlgcqic

SCOPe Domain Coordinates for d3n9yc_:

Click to download the PDB-style file with coordinates for d3n9yc_.
(The format of our PDB-style files is described here.)

Timeline for d3n9yc_: