SCOPe 2.08: Domain d3n9wa_: 3n9w A:

Lineage for d3n9wa_ (3n9w A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)

6. Protein automated matches [190992] (6 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189105] (2 PDB entries)

8. Domain d3n9wa_: 3n9w A: [182105]
   automated match to d1h3mb_
   complexed with pgo, pgr

Details for d3n9wa_

PDB Entry: 3n9w, 1.9 Å

PDB Description: crystal structure of 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase (ispd) in complex with 1,2-propanediol

PDB Compounds: (A:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d3n9wa_:

Sequence, based on SEQRES records:

>d3n9wa_ c.68.1.13 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ldvcavvpaagfgrrmqtecpkqylsignqtilehsvhallahprvkrvviaispgdsrf
aqlplanhpqitvvdggderadsvlaglkaagdaqwvlvhdaarpclhqddlarllalse
tsrtggilaapvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltralneg
atitdeasaleycgfhpqlvegradnikvtrpedlalaefylt

Sequence, based on observed residues (ATOM records):

>d3n9wa_ c.68.1.13 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ldvcavvpaanqtilehsvhallahprvkrvviaiplanhpqitvvdggderadsvlagl
kaagdaqwvlvhdaarpclhqddlarllalsetsrtggilaapvrdtmkraepgknaiah
tvdrnglwhaltpqffprellhdcltralnegatitdeasaleycgfhpqlvegradnik
vtrpedlalaefylt

Timeline for d3n9wa_:

• d3n9wa_ first appeared in SCOPe 2.01
  
• d3n9wa_ appears in SCOPe 2.07