Lineage for d3n9sb_ (3n9s B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (75 species)
    not a true protein
  7. 2086708Species Helicobacter pylori [TaxId:290847] [189516] (2 PDB entries)
  8. 2086718Domain d3n9sb_: 3n9s B: [182104]
    automated match to d1rv8a_
    complexed with ca, na, td4, zn

Details for d3n9sb_

PDB Entry: 3n9s (more details), 1.85 Å

PDB Description: Class II fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with N-(4-hydroxybutyl)- glycolohydroxamic acid bis-phosphate, a competitive inhibitor
PDB Compounds: (B:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d3n9sb_:

Sequence, based on SEQRES records: (download)

>d3n9sb_ c.1.10.0 (B:) automated matches {Helicobacter pylori [TaxId: 290847]}
mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
vkmahnagvsveaelgrlmgiednisvdekdavlvnpkeaeqfvkesqvdylapaigtsh
gafkfkgepkldferlqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfef
lqesvkgginkvntdtdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkl
lgsanki

Sequence, based on observed residues (ATOM records): (download)

>d3n9sb_ c.1.10.0 (B:) automated matches {Helicobacter pylori [TaxId: 290847]}
mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
vkmahnagvsveaelgrlmavlvnpkeaeqfvkesqvdylapaigtshgafkfkgepkld
ferlqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfeflqesvkgginkv
ntdtdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkllgsanki

SCOPe Domain Coordinates for d3n9sb_:

Click to download the PDB-style file with coordinates for d3n9sb_.
(The format of our PDB-style files is described here.)

Timeline for d3n9sb_: