Lineage for d3n9sa_ (3n9s A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1342158Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1343361Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1343362Protein automated matches [190115] (51 species)
    not a true protein
  7. 1343543Species Helicobacter pylori [TaxId:290847] [189516] (2 PDB entries)
  8. 1343552Domain d3n9sa_: 3n9s A: [182103]
    automated match to d1rv8a_
    complexed with ca, na, td4, zn

Details for d3n9sa_

PDB Entry: 3n9s (more details), 1.85 Å

PDB Description: Class II fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with N-(4-hydroxybutyl)- glycolohydroxamic acid bis-phosphate, a competitive inhibitor
PDB Compounds: (A:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d3n9sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n9sa_ c.1.10.0 (A:) automated matches {Helicobacter pylori [TaxId: 290847]}
mlvkgneillkahkegygvgafnfvnfemlnaifeagneensplfiqasegaikymgidm
avgmvkimceryphipvalhldhgttfescekavkagftsvmidashhafeenleltskv
vkmahnagvsveaelgrlmgiednisvdekdavlvnpkeaeqfvkesqvdylapaigtsh
gafkfkgepkldferlqevkrltniplvlhgasaipdnvrksyldaggdlkgskgvpfef
lqesvkgginkvntdtdlriafiaevrkvanedksqfdlrkffspaqlalknvvkermkl
lgsanki

SCOPe Domain Coordinates for d3n9sa_:

Click to download the PDB-style file with coordinates for d3n9sa_.
(The format of our PDB-style files is described here.)

Timeline for d3n9sa_: