SCOP 1.73: Domain d1cipa1: 1cip A:61-181

Lineage for d1cipa1 (1cip A:61-181)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47899] (24 PDB entries)

8. Domain d1cipa1: 1cip A:61-181 [18210]
   Other proteins in same PDB: d1cipa2
   complexed with gnp, mg

Details for d1cipa1

PDB Entry: 1cip, 1.5 Å

PDB Description: gi-alpha-1 subunit of guanine nucleotide-binding protein complexed with a gtp analogue

PDB Compounds: (A:) protein (guanine nucleotide-binding protein alpha-1 subunit)

SCOP Domain Sequences for d1cipa1:

Sequence; same for both SEQRES and ATOM records:

>d1cipa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus) [TaxId: 10116]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Timeline for d1cipa1:

• d1cipa1 first appeared (with stable ids) in SCOP 1.55
  
• d1cipa1 appears in SCOP 1.71
  
• d1cipa1 appears in SCOP 1.75
  
• d1cipa1 appears in the current release, SCOPe 2.08