Lineage for d1cipa1 (1cip A:61-181)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215151Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 215152Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 215153Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 215154Protein Transducin (alpha subunit), insertion domain [47897] (2 species)
  7. 215172Species Rat (Rattus norvegicus) [TaxId:10116] [47899] (18 PDB entries)
  8. 215173Domain d1cipa1: 1cip A:61-181 [18210]
    Other proteins in same PDB: d1cipa2
    complexed with gnp, mg

Details for d1cipa1

PDB Entry: 1cip (more details), 1.5 Å

PDB Description: gi-alpha-1 subunit of guanine nucleotide-binding protein complexed with a gtp analogue

SCOP Domain Sequences for d1cipa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cipa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus)}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

SCOP Domain Coordinates for d1cipa1:

Click to download the PDB-style file with coordinates for d1cipa1.
(The format of our PDB-style files is described here.)

Timeline for d1cipa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cipa2