SCOP 1.73: Domain d1cjkc1: 1cjk C:86-201

Lineage for d1cjkc1 (1cjk C:86-201)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47898] (15 PDB entries)

8. Domain d1cjkc1: 1cjk C:86-201 [18209]
   Other proteins in same PDB: d1cjka_, d1cjkb_, d1cjkc2
   complexed with ags, cl, fok, gsp, mes, mg, mn; mutant

Details for d1cjkc1

PDB Entry: 1cjk, 3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with adenosine 5'-(alpha thio)-triphosphate (rp), mg, and mn

PDB Compounds: (C:) guanine nucleotide-binding protein g(s)

SCOP Domain Sequences for d1cjkc1:

Sequence; same for both SEQRES and ATOM records:

>d1cjkc1 a.66.1.1 (C:86-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
gekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppe
fyehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr

Timeline for d1cjkc1:

• d1cjkc1 first appeared (with stable ids) in SCOP 1.55
  
• d1cjkc1 appears in SCOP 1.71
  
• d1cjkc1 appears in SCOP 1.75
  
• d1cjkc1 appears in the current release, SCOPe 2.08