Class a: All alpha proteins [46456] (171 folds) |
Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) this domain interrupts the G-protein common fold |
Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
Protein Transducin (alpha subunit), insertion domain [47897] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [47898] (11 PDB entries) |
Domain d1cjkc1: 1cjk C:86-201 [18209] Other proteins in same PDB: d1cjka_, d1cjkb_, d1cjkc2 complexed with ags, cl, fok, gsp, mes, mg, mn; mutant |
PDB Entry: 1cjk (more details), 3 Å
SCOP Domain Sequences for d1cjkc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cjkc1 a.66.1.1 (C:86-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus)} gekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppe fyehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr
Timeline for d1cjkc1: