![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
![]() | Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) ![]() this domain interrupts the G-protein common fold |
![]() | Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
![]() | Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [47898] (15 PDB entries) |
![]() | Domain d1cjvc1: 1cjv C:87-201 [18208] Other proteins in same PDB: d1cjva_, d1cjvb_, d1cjvc2 complexed with cl, dad, fok, gsp, mes, mg, zn; mutant |
PDB Entry: 1cjv (more details), 3 Å
SCOP Domain Sequences for d1cjvc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cjvc1 a.66.1.1 (C:87-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} ekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppef yehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr
Timeline for d1cjvc1: