SCOP 1.75: Domain d1cjvc1: 1cjv C:87-201

Lineage for d1cjvc1 (1cjv C:87-201)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47898] (15 PDB entries)

8. Domain d1cjvc1: 1cjv C:87-201 [18208]
   Other proteins in same PDB: d1cjva_, d1cjvb_, d1cjvc2
   complexed with cl, dad, fok, gsp, mes, mg, zn; mutant

Details for d1cjvc1

PDB Entry: 1cjv, 3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp, mg, and zn

PDB Compounds: (C:) guanine nucleotide-binding protein g(s)

SCOP Domain Sequences for d1cjvc1:

Sequence; same for both SEQRES and ATOM records:

>d1cjvc1 a.66.1.1 (C:87-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
ekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppef
yehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr

Timeline for d1cjvc1:

• d1cjvc1 first appeared (with stable ids) in SCOP 1.55
  
• d1cjvc1 appears in SCOP 1.73
  
• d1cjvc1 appears in SCOPe 2.01
  
• d1cjvc1 appears in the current release, SCOPe 2.08