![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
![]() | Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) ![]() this domain interrupts the G-protein common fold |
![]() | Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
![]() | Protein Transducin (alpha subunit), insertion domain [47897] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [47898] (15 PDB entries) |
![]() | Domain d1cjuc1: 1cju C:86-201 [18207] Other proteins in same PDB: d1cjua_, d1cjub_, d1cjuc2 complexed with cl, dad, fok, gsp, mg; mutant |
PDB Entry: 1cju (more details), 2.8 Å
SCOP Domain Sequences for d1cjuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cjuc1 a.66.1.1 (C:86-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} gekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppe fyehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr
Timeline for d1cjuc1: