SCOPe 2.08: Domain d1cjuc1: 1cju C:86-201

Lineage for d1cjuc1 (1cju C:86-201)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47898] (18 PDB entries)

8. Domain d1cjuc1: 1cju C:86-201 [18207]
   Other proteins in same PDB: d1cjua_, d1cjub_, d1cjuc2
   complexed with cl, dad, fok, gsp, mg

Details for d1cjuc1

PDB Entry: 1cju, 2.8 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp and mg

PDB Compounds: (C:) guanine nucleotide-binding protein g(s)

SCOPe Domain Sequences for d1cjuc1:

Sequence; same for both SEQRES and ATOM records:

>d1cjuc1 a.66.1.1 (C:86-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
gekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppe
fyehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr

Timeline for d1cjuc1:

• d1cjuc1 first appeared (with stable ids) in SCOP 1.55
  
• d1cjuc1 appears in SCOPe 2.07