Lineage for d3n8ia_ (3n8i A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1167540Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 1167541Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 1167542Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
  6. 1167566Protein Tyrosine phosphatase [52790] (5 species)
  7. 1167583Species Human (Homo sapiens) [TaxId:9606] [52792] (3 PDB entries)
  8. 1167584Domain d3n8ia_: 3n8i A: [182065]
    automated match to d5pnta_
    complexed with nla

Details for d3n8ia_

PDB Entry: 3n8i (more details), 1.5 Å

PDB Description: Crystal structure of the A isoform of human cytoplasmic protein tyrosine phosphatase (HCPTP-A) in complex with 1-naphtylacetic acid
PDB Compounds: (A:) Low molecular weight phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d3n8ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n8ia_ c.44.1.1 (A:) Tyrosine phosphatase {Human (Homo sapiens) [TaxId: 9606]}
atksvlfvclgnicrspiaeavfrklvtdqnisenwrvdsaatsgyeignppdyrgqscm
krhgipmshvarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsydpqk
qliiedpyygndsdfetvyqqcvrccraflekah

SCOPe Domain Coordinates for d3n8ia_:

Click to download the PDB-style file with coordinates for d3n8ia_.
(The format of our PDB-style files is described here.)

Timeline for d3n8ia_: