| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) ![]() share the common active site structure with the family II |
| Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins) automatically mapped to Pfam PF01451 |
| Protein Tyrosine phosphatase [52790] (5 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52792] (13 PDB entries) |
| Domain d3n8ia_: 3n8i A: [182065] automated match to d5pnta_ complexed with nla |
PDB Entry: 3n8i (more details), 1.5 Å
SCOPe Domain Sequences for d3n8ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n8ia_ c.44.1.1 (A:) Tyrosine phosphatase {Human (Homo sapiens) [TaxId: 9606]}
atksvlfvclgnicrspiaeavfrklvtdqnisenwrvdsaatsgyeignppdyrgqscm
krhgipmshvarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsydpqk
qliiedpyygndsdfetvyqqcvrccraflekah
Timeline for d3n8ia_: