Lineage for d1cs4c1 (1cs4 C:86-201)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717222Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 2717223Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 2717224Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 2717225Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 2717226Species Cow (Bos taurus) [TaxId:9913] [47898] (18 PDB entries)
  8. 2717235Domain d1cs4c1: 1cs4 C:86-201 [18205]
    Other proteins in same PDB: d1cs4a_, d1cs4b_, d1cs4c2
    complexed with 101, cl, fok, gsp, mes, mg, pop

Details for d1cs4c1

PDB Entry: 1cs4 (more details), 2.5 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2'-deoxy-adenosine 3'-monophosphate, pyrophosphate and mg
PDB Compounds: (C:) guanine nucleotide-binding protein g(s)

SCOPe Domain Sequences for d1cs4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cs4c1 a.66.1.1 (C:86-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
gekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppe
fyehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr

SCOPe Domain Coordinates for d1cs4c1:

Click to download the PDB-style file with coordinates for d1cs4c1.
(The format of our PDB-style files is described here.)

Timeline for d1cs4c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cs4c2