SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3n87b_ (3n87 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2103506Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2103507Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 protein domains)
    automatically mapped to Pfam PF01220
  6. 2103621Protein automated matches [190071] (5 species)
    not a true protein
  7. 2103654Species Mycobacterium tuberculosis [TaxId:1773] [189947] (16 PDB entries)
  8. 2103755Domain d3n87b_: 3n87 B: [182042]
    automated match to d1h05a_
    complexed with n87

Details for d3n87b_

PDB Entry: 3n87 (more details), 2.4 Å

PDB Description: Crystal structure of 3-dehydroquinate dehydratase from Mycobacterium tuberculosis in complex with inhibitor 3
PDB Compounds: (B:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d3n87b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n87b_ c.23.13.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
gvivglgiqgyllalrylaeh

SCOPe Domain Coordinates for d3n87b_:

Click to download the PDB-style file with coordinates for d3n87b_.
(The format of our PDB-style files is described here.)

Timeline for d3n87b_: