SCOP 1.75: Domain d1culc1: 1cul C:86-201

Lineage for d1culc1 (1cul C:86-201)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47898] (15 PDB entries)

8. Domain d1culc1: 1cul C:86-201 [18204]
   Other proteins in same PDB: d1cula_, d1culb_, d1culc2
   complexed with 103, 3po, cl, fok, gsp, mes, mg; mutant

Details for d1culc1

PDB Entry: 1cul, 2.4 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with 2',5'-dideoxy-adenosine 3'-triphosphate and mg

PDB Compounds: (C:) guanine nucleotide-binding protein g(s)

SCOP Domain Sequences for d1culc1:

Sequence; same for both SEQRES and ATOM records:

>d1culc1 a.66.1.1 (C:86-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
gekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppe
fyehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr

Timeline for d1culc1:

• d1culc1 first appeared (with stable ids) in SCOP 1.55
  
• d1culc1 appears in SCOP 1.73
  
• d1culc1 appears in SCOPe 2.01
  
• d1culc1 appears in the current release, SCOPe 2.08