Lineage for d3n86q_ (3n86 Q:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857821Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2857822Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 2857936Protein automated matches [190071] (6 species)
    not a true protein
  7. 2858010Species Mycobacterium tuberculosis [TaxId:1773] [189947] (16 PDB entries)
  8. 2858101Domain d3n86q_: 3n86 Q: [182033]
    automated match to d1h05a_
    complexed with rjp

Details for d3n86q_

PDB Entry: 3n86 (more details), 1.9 Å

PDB Description: crystal structure of 3-dehydroquinate dehydratase from mycobacterium tuberculosis in complex with inhibitor 4
PDB Compounds: (Q:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d3n86q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n86q_ c.23.13.1 (Q:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
gvivglgiqgyllalrylaeh

SCOPe Domain Coordinates for d3n86q_:

Click to download the PDB-style file with coordinates for d3n86q_.
(The format of our PDB-style files is described here.)

Timeline for d3n86q_: