| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) ![]() |
| Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins) automatically mapped to Pfam PF01220 |
| Protein automated matches [190071] (6 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [189947] (16 PDB entries) |
| Domain d3n86o_: 3n86 O: [182031] automated match to d1h05a_ complexed with rjp |
PDB Entry: 3n86 (more details), 1.9 Å
SCOPe Domain Sequences for d3n86o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n86o_ c.23.13.1 (O:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
livnvingpnlgrlgrrepavyggtthdelvaliereaaelglkavvrqsdseaqlldwi
hqaadaaepvilnagglthtsvalrdacaelsaplievhisnvhareefrrhsylspiat
gvivglgiqgyllalrylaeh
Timeline for d3n86o_: