![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
![]() | Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) ![]() this domain interrupts the G-protein common fold |
![]() | Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
![]() | Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [47898] (18 PDB entries) |
![]() | Domain d1azsc1: 1azs C:86-201 [18203] Other proteins in same PDB: d1azsa_, d1azsb_, d1azsc2 complexed with fkp, gsp, mg |
PDB Entry: 1azs (more details), 2.3 Å
SCOPe Domain Sequences for d1azsc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1azsc1 a.66.1.1 (C:86-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} gekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppe fyehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr
Timeline for d1azsc1: