Lineage for d1aztb1 (1azt B:87-201)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002645Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 2002646Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 2002647Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 2002648Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 2002649Species Cow (Bos taurus) [TaxId:9913] [47898] (18 PDB entries)
  8. 2002658Domain d1aztb1: 1azt B:87-201 [18202]
    Other proteins in same PDB: d1azta2, d1aztb2
    complexed with gsp, mg, po4

Details for d1aztb1

PDB Entry: 1azt (more details), 2.3 Å

PDB Description: gs-alpha complexed with gtp-gamma-s
PDB Compounds: (B:) gs-alpha

SCOPe Domain Sequences for d1aztb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aztb1 a.66.1.1 (B:87-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
ekatkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppef
yehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr

SCOPe Domain Coordinates for d1aztb1:

Click to download the PDB-style file with coordinates for d1aztb1.
(The format of our PDB-style files is described here.)

Timeline for d1aztb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aztb2