Lineage for d3n84f_ (3n84 F:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1035347Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 1035348Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1035349Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1035496Protein Growth factor receptor-bound protein 2 (GRB2) [55563] (1 species)
  7. 1035497Species Human (Homo sapiens) [TaxId:9606] [55564] (31 PDB entries)
  8. 1035518Domain d3n84f_: 3n84 F: [182016]
    automated match to d1fhsa_
    complexed with cl, gol, mg

Details for d3n84f_

PDB Entry: 3n84 (more details), 2 Å

PDB Description: Crystal Structure of the Grb2 SH2 Domain in Complex with a 23-Membered Macrocyclic Ligand Having the Sequence pYVNVP
PDB Compounds: (F:) Growth factor receptor-bound protein 2

SCOPe Domain Sequences for d3n84f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3n84f_ d.93.1.1 (F:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]}
iemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlr
dgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieq

SCOPe Domain Coordinates for d3n84f_:

Click to download the PDB-style file with coordinates for d3n84f_.
(The format of our PDB-style files is described here.)

Timeline for d3n84f_: