SCOPe 2.07: Domain d1azta1: 1azt A:88-201

Lineage for d1azta1 (1azt A:88-201)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47898] (18 PDB entries)

8. Domain d1azta1: 1azt A:88-201 [18201]
   Other proteins in same PDB: d1azta2, d1aztb2
   complexed with gsp, mg, po4

Details for d1azta1

PDB Entry: 1azt, 2.3 Å

PDB Description: gs-alpha complexed with gtp-gamma-s

PDB Compounds: (A:) gs-alpha

SCOPe Domain Sequences for d1azta1:

Sequence; same for both SEQRES and ATOM records:

>d1azta1 a.66.1.1 (A:88-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
katkvqdiknnlkeaietivaamsnlvppvelanpenqfrvdyilsvmnvpdfdfppefy
ehakalwedegvracyersneyqlidcaqyfldkidvikqddyvpsdqdllrcr

Timeline for d1azta1:

• d1azta1 first appeared (with stable ids) in SCOP 1.55
  
• d1azta1 appears in SCOPe 2.06
  
• d1azta1 appears in the current release, SCOPe 2.08