Lineage for d1tndb1 (1tnd B:57-177)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 771834Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 771835Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 771836Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 771837Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 771838Species Cow (Bos taurus) [TaxId:9913] [47898] (15 PDB entries)
  8. 771849Domain d1tndb1: 1tnd B:57-177 [18199]
    Other proteins in same PDB: d1tnda2, d1tndb2, d1tndc2

Details for d1tndb1

PDB Entry: 1tnd (more details), 2.2 Å

PDB Description: the 2.2 angstroms crystal structure of transducin-alpha complexed with gtp gamma s
PDB Compounds: (B:) transducin

SCOP Domain Sequences for d1tndb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tndb1 a.66.1.1 (B:57-177) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]}
ysleeclefiaiiygntlqsilaivramttlniqygdsarqddarklmhmadtieegtmp
kemsdiiqrlwkdsgiqacfdraseyqlndsagyylsdlerlvtpgyvpteqdvlrsrvk
t

SCOP Domain Coordinates for d1tndb1:

Click to download the PDB-style file with coordinates for d1tndb1.
(The format of our PDB-style files is described here.)

Timeline for d1tndb1: